Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Chlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327))
Uniprot NO.:B3QNH3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHLSSDEVVLWQSGFLKLNLTIVTTWAVMLLLAGGSWLITRRLSTGITISRWQSVLEIIV TMARRQIGEVGLQKPEKYLPFIATLFLFIATANLCTVIPGYEPPTGSLSTTAALALSVFI AVPLFGIAESGLVGYLKTYAEPTPIMLPFNIVGELTRTMALAVRLFGNMMSGDMILVILL TISPLVFPVLMNILGLLTGMVQAYIFSILATVYIAAATRTREKSTS
Protein Names:Recommended name: ATP synthase subunit a 1 Alternative name(s): ATP synthase F0 sector subunit a 1 F-ATPase subunit 6 1
Gene Names:Name:atpB1 Ordered Locus Names:Cpar_1068
Expression Region:1-226
Sequence Info:full length protein