Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chlamydia muridarum UPF0056 membrane protein TC_0241(TC_0241)

Recombinant Chlamydia muridarum UPF0056 membrane protein TC_0241(TC_0241)

SKU:CSB-CF879281CIU

Regular price €1.484,95 EUR
Regular price Sale price €1.484,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Chlamydia muridarum (strain MoPn / Nigg)

Uniprot NO.:Q9PL67

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLHSLFRLTLLFYALFNSLGSLPVFVALLKKFSFRKQQRIILRECIFALLTLILFITFGQ GFFRLLEVSLPAFQLTGGILLGSLAINMMKALPSQEETFDQYEDEPIFYPLAFPVITGPA TITSTLGHMEEGIFPKELVLGAIMLAWAFSLITLFFSSSINRLFGQMGLLALERLFGISL ALMAGNLMLKAISTAFNIGYYVMA

Protein Names:Recommended name: UPF0056 membrane protein TC_0241

Gene Names:Ordered Locus Names:TC_0241

Expression Region:1-204

Sequence Info:full length protein

View full details