Gene Bio Systems
Recombinant Chicken Transmembrane protein 70, mitochondrial(TMEM70)
Recombinant Chicken Transmembrane protein 70, mitochondrial(TMEM70)
SKU:CSB-CF726533CH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Gallus gallus (Chicken)
Uniprot NO.:Q5ZLJ4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:HPEHGRLVYKGNLAKAVLGVRFFSYSTSIFNLFMAPYLMLKTGIGFDSLFLQAAFYGLIG FFTFVTPVTLHILTKGYVIRLYYKEEMDTYTAITYNAILAEKATVFHQKDVKIPDITKMF TTFYAKTKSMLVNPTLFPDPQDYNRLMGYDKAFCFDFEEEEKDGESK
Protein Names:Recommended name: Transmembrane protein 70, mitochondrial
Gene Names:Name:TMEM70 ORF Names:RCJMB04_5o22
Expression Region:80-246
Sequence Info:full length protein
