Recombinant Chicken Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDHD)

SKU: CSB-CF719989CH

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q5ZIS0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SHGGAPQGHGSSKAASLHWTSERAVSALLLGLLPAAYLYPGPAVDYSLAAALTLHGHWGL GQVITDYVHGDTPIKVANTGLYVLSAITFTGLCYFNYYDVGICKAVAMLWSI

Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Short name= CybS Alternative name(s): Succinate dehydrogenase complex subunit D Succinate-ubiquinone oxidoreductase cytochrome b small subu

Gene Names:Name:SDHD ORF Names:RCJMB04_23p7

Expression Region:46-157

Sequence Info:full length protein