Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Ephrin-B1(EFNB1)

Recombinant Chicken Ephrin-B1(EFNB1)

SKU:CSB-CF007465CH

Regular price €1.593,95 EUR
Regular price Sale price €1.593,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:O73612

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KSLEPVSWSAGNPKFMSGKGLVIYPEIGDKLDIICPKAEPSKPYDYYKLYLVKKDQADACSTVMDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKRQQDYFITSTSNGTLDGLENREGGVCQTRSMKIVMKVGQDPNAVIPEQLTTSRPSKEADNTVKIVTQSPRHKVPTVEEPGKPGSVNQNGQETQGPSDGFLSSKVAVFAAIGAGCVIFILIIIFLVVLLIKIRKRHRKHTQQRAAALSLSTLASPKCSGNAGSEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV

Protein Names:Recommended name: Ephrin-B1 Alternative name(s): CEK5 ligand Short name= CEK5-L

Gene Names:Name:EFNB1

Expression Region:26-334

Sequence Info:full length protein

View full details