Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken (Chicken) Mitochondrial Rho GTPase 1(RHOT1),partial

Recombinant Chicken (Chicken) Mitochondrial Rho GTPase 1(RHOT1),partial

SKU:CSB-EP720036CH

Regular price €1.017,95 EUR
Regular price Sale price €1.017,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Tags & Cell Markers

Uniprot ID: Q5ZM73

Gene Names: RHOT1

Organism: Gallus gallus (Chicken)

AA Sequence: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQNDEQLYHEISQANVICIVYAVNNKNSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVECSAKNLKNRSELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFRISDQDNDGTLNDAELNFFQRICFNT

Expression Region: 1-219aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 41 kDa

Alternative Name(s): MIRO-1 Alternative name(s): Ras homolog gene family member T1

Relevance: Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution (By similarity).

Reference: "Full-length cDNAs from chicken bursal lymphocytes to facilitate gene function analysis."Caldwell R.B., Kierzek A.M., Arakawa H., Bezzubov Y., Zaim J., Fiedler P., Kutter S., Blagodatski A., Kostovska D., Koter M., Plachy J., Carninci P., Hayashizaki Y., Buerstedde J.-M.Genome Biol. 6:R6.1-R6.9(2005).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details