Gene Bio Systems
Recombinant Ceratitis capitata Ribonuclease kappa-B
Recombinant Ceratitis capitata Ribonuclease kappa-B
SKU:CSB-CF770337DRF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata)
Uniprot NO.:Q7Z0Q2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKICGPKLSLCGLIISVWGIIQLVLMGLFFYINSVALIEDLPIDEEFNSVEEFYTAATSA YNQNAYNCWIAACIYVLTLLLSAQQFYVNSRATAN
Protein Names:Recommended name: Ribonuclease kappa-B Short name= RNase K-B Short name= RNase kappa-B EC= 3.1.-.- Alternative name(s): Cc RNase
Gene Names:
Expression Region:1-95
Sequence Info:full length protein
