Recombinant Centruroides suffusus suffusus Beta-mammal toxin Css4

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Centruroides suffusus suffusus Beta-mammal toxin Css4

CSB-EP350214DRC
Regular price
€747,95 EUR
Sale price
€747,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P60266

Gene Names: N/A

Organism: Centruroides suffusus suffusus (Mexican scorpion)

AA Sequence: KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN

Expression Region: 1-66aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 23.6 kDa

Alternative Name(s):

Relevance: Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.

Reference: Neutralization of gating charges in domain II of the sodium channel alpha subunit enhances voltage-sensor trapping by a beta-scorpion toxin.Cestele S., Scheuer T., Mantegazza M., Rochat H., Catterall W.A.J. Gen. Physiol. 118:291-302(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Centruroides suffusus suffusu Beta-mammal toxin Css4
    Regular price
    €747,95 EUR
    Sale price
    €747,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Centruroides suffusus suffusus Beta-mammal toxin Css4
    Regular price
    €820,95 EUR
    Sale price
    €820,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Centruroides noxius Beta-mammal toxin Cn2
    Regular price
    €747,95 EUR
    Sale price
    €747,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Centruroides noxius Beta-mammal toxin Cn2
    Regular price
    €820,95 EUR
    Sale price
    €820,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share