
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P60266
Gene Names: N/A
Organism: Centruroides suffusus suffusus (Mexican scorpion)
AA Sequence: KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN
Expression Region: 1-66aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 23.6 kDa
Alternative Name(s):
Relevance: Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.
Reference: Neutralization of gating charges in domain II of the sodium channel alpha subunit enhances voltage-sensor trapping by a beta-scorpion toxin.Cestele S., Scheuer T., Mantegazza M., Rochat H., Catterall W.A.J. Gen. Physiol. 118:291-302(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Centruroides suffusus suffusu Beta-mammal toxin Css4
- Regular price
- €747,95 EUR
- Sale price
- €747,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Centruroides suffusus suffusus Beta-mammal toxin Css4
- Regular price
- €820,95 EUR
- Sale price
- €820,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Centruroides noxius Beta-mammal toxin Cn2
- Regular price
- €747,95 EUR
- Sale price
- €747,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Centruroides noxius Beta-mammal toxin Cn2
- Regular price
- €820,95 EUR
- Sale price
- €820,95 EUR
- Regular price
-
- Unit price
- per
Sold out