Skip to product information
1 of 1

Gene Bio Systems

Recombinant Carboxydothermus hydrogenoformans UPF0059 membrane protein CHY_2560(CHY_2560)

Recombinant Carboxydothermus hydrogenoformans UPF0059 membrane protein CHY_2560(CHY_2560)

SKU:CSB-CF663958CDJ

Regular price €1.456,95 EUR
Regular price Sale price €1.456,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008)

Uniprot NO.:Q3A931

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLWEIFLLAVALGTDSFSLCVGLGMGKIKRKEIIALSLTVLVYHIVMPILGWFAGDLTG RFLGKVATYIGGAILIYLGYKMIRHGISQEEELPHVTYNLVGLLLIGLSVSMDALSVGFT LGTVKVNLWFVALITGIVAGVMTLSGLLLGRRVSKVLGERAQIVGGLILLLIAGKLIFRG

Protein Names:Recommended name: UPF0059 membrane protein CHY_2560

Gene Names:Ordered Locus Names:CHY_2560

Expression Region:1-180

Sequence Info:full length protein

View full details