Recombinant Candida dubliniensis Cytochrome oxidase assembly protein 3, mitochondrial(COA3)

SKU: CSB-CF496087CZH

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) (Yeast)

Uniprot NO.:B9WK46

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGKLVGAPKGHDRYRDPKTHQITPALYRVRAPFFWRNTIALFAVSSIPLAVYLYTFKKMG DDDLGDIPIPPISDEELQKLKLEYENQK

Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial

Gene Names:Name:COA3 ORF Names:CD36_71440

Expression Region:1-88

Sequence Info:full length protein