Skip to product information
1 of 1

Gene Bio Systems

Recombinant Candida dubliniensis Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

Recombinant Candida dubliniensis Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

SKU:CSB-CF497517CZH

Regular price €1.443,95 EUR
Regular price Sale price €1.443,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) (Yeast)

Uniprot NO.:B9WHT6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVRLPSSMSYGEEEEPDVLQKMWEKSKQQPFVPLGSLLTAGAVLLAARSMKRGEKLKTQ RYFRYRIGFQLATLVALVGGGFYYGTETSEHKQIREDKLREKAKQREKLWIEELERRDSI IQARKQRLEESKKELRELAKQGFIEEKESNDEKED

Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial

Gene Names:Name:AIM31 ORF Names:CD36_53530

Expression Region:1-155

Sequence Info:full length protein

View full details