Gene Bio Systems
Recombinant Candida albicans Presequence translocated-associated motor subunit PAM17, mitochondrial(PAM17)
Recombinant Candida albicans Presequence translocated-associated motor subunit PAM17, mitochondrial(PAM17)
SKU:CSB-CF682478CZD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Uniprot NO.:Q5AEM8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:NTIAGVFTGLGGAFITLSYLGNIEIDVEKPIMGFDPLMVMGGAVILGGLVGFLVGPFIGS SIFRLTNRAQLKQFELKNTEFLSRLRIKRPDPSSQSFSNPIPDYYGEKIYSLKDYKQWLR DCNAFRRKSKEFL
Protein Names:Recommended name: Presequence translocated-associated motor subunit PAM17, mitochondrial
Gene Names:Name:PAM17 ORF Names:CaO19.240, CaO19.7870
Expression Region:53-185
Sequence Info:full length protein
