Gene Bio Systems
Recombinant Candida albicans NADH-ubiquinone oxidoreductase chain 4L(NAD4L)
Recombinant Candida albicans NADH-ubiquinone oxidoreductase chain 4L(NAD4L)
SKU:CSB-CF858969CZD-GB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Uniprot NO.:Q9B8D0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIAVITTLLTYYMSSNNLITLLIAIEILLLTVTLKLIHISGYYDDIYGTIFSLIIIILAG AESAIGLSILVAYYRLRGTIGHSI
Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4L EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4L
Gene Names:Name:NAD4L ORF Names:CaalfMp12
Expression Region:1-84
Sequence Info:full length protein
