Gene Bio Systems
Recombinant Caldicellulosiruptor sp. Putative ABC transporter permease protein ORF1
Recombinant Caldicellulosiruptor sp. Putative ABC transporter permease protein ORF1
SKU:CSB-CF336808CAL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caldicellulosiruptor sp. (strain Rt8B.4)
Uniprot NO.:P40979
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:DPNVAFYSVVAVICWQYIPFYMIFFIAALSNIPQELYEAAKIDGATQGQYFWRIELPLLT PSIKTACILSLIGSLKYFDLIYVMTEGGPSNATELMATYMYKNAFASFKMGYGSTIASAM FLIITTAGIFAYFVTRRKEE
Protein Names:Recommended name: Putative ABC transporter permease protein ORF1
Gene Names:
Expression Region:1-140
Sequence Info:full length protein
