Recombinant Burkholderia vietnamiensis  NADH-quinone oxidoreductase subunit A(nuoA)

Recombinant Burkholderia vietnamiensis NADH-quinone oxidoreductase subunit A(nuoA)

CSB-CF391324BPV
Regular price
€1.018,95 EUR
Sale price
€1.018,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Burkholderia vietnamiensis (strain G4 / LMG 22486) (Burkholderia cepacia (strain R1808))

Uniprot NO.:A4JGD0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVDKNAPYECGFEAFEDARMKFDVR YYLVAILFIIFDLETAFLFPWGVALRDIGWPGFSAMMIFLLEFLLGFAYIWKKGGLDWE

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1

Gene Names:Name:nuoA Ordered Locus Names:Bcep1808_2334

Expression Region:1-119

Sequence Info:full length protein

Your list is ready to share