Gene Bio Systems
Recombinant Burkholderia phytofirmans UPF0060 membrane protein Bphyt_4776 (Bphyt_4776)
Recombinant Burkholderia phytofirmans UPF0060 membrane protein Bphyt_4776 (Bphyt_4776)
SKU:CSB-CF462571BXU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Burkholderia phytofirmans (strain DSM 17436 / PsJN)
Uniprot NO.:B2TDV1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKTFLLYAVTAVAEVVGCYLPWRWLKEGGSIWLLVPGALSLALFAWLLTLHGTAAGRVYA AYGGVYVAVAIAWLWCVDKVRPTLWDAAGVAFTLAGMAIIAFQPRV
Protein Names:Recommended name: UPF0060 membrane protein Bphyt_4776
Gene Names:Ordered Locus Names:Bphyt_4776
Expression Region:1-106
Sequence Info:full length protein
