Skip to product information
1 of 1

Gene Bio Systems

Recombinant Burkholderia phytofirmans UPF0059 membrane protein Bphyt_6717 (Bphyt_6717)

Recombinant Burkholderia phytofirmans UPF0059 membrane protein Bphyt_6717 (Bphyt_6717)

SKU:CSB-CF454812BXU

Regular price €1.465,95 EUR
Regular price Sale price €1.465,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Burkholderia phytofirmans (strain DSM 17436 / PsJN)

Uniprot NO.:B2T9B0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNPVATLFLAFAMSTDAFAAAIGKGATLNRPHWREAVRTGLIFGVIEALTPLVGWFLGKA AAQYVSAWDHWIAFSLLLVLGARMVFNSFNTKEVEETKPSAHSFWLLALTGFATSIDAMA VGAGLAFVDVNIYSTAAAIGLATMAMVTIGVMLGRVIGHVAGRRAELAGGIVLIGIGSTI LAEHLNIFG

Protein Names:Recommended name: UPF0059 membrane protein Bphyt_6717

Gene Names:Ordered Locus Names:Bphyt_6717

Expression Region:1-189

Sequence Info:full length protein

View full details