Gene Bio Systems
Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0114 protein in repA1-repA2 intergenic region (BUsg_PL2)
Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0114 protein in repA1-repA2 intergenic region (BUsg_PL2)
SKU:CSB-CF525954BXE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Uniprot NO.:O85061
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEKIIEKSIYASRWLMFPVYVGLSFGFILLTLKFFQQIIFIIPDILAMSESGLVLAVLSL IDIALVGGLLVMVMFSGYENFISKMDIQDNEKRLGWMGTMDVNSIKNKVASSIVAISSVH LLRLFMEAERILDNKIMLCVIIRLTFVLSAFGMAYIDKMSKKKDNLH
Protein Names:Recommended name: UPF0114 protein in repA1-repA2 intergenic region
Gene Names:Ordered Locus Names:BUsg_PL2
Expression Region:1-167
Sequence Info:full length protein
