Skip to product information
1 of 1

Gene Bio Systems

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Cytochrome o ubiquinol oxidase protein CyoD(cyoD)

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Cytochrome o ubiquinol oxidase protein CyoD(cyoD)

SKU:CSB-CF809136BXE

Regular price €1.382,95 EUR
Regular price Sale price €1.382,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Uniprot NO.:Q8K996

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNKYKKIKNNFDKEKKSYIVGFLFSLFLTIIPFFCTLNHLFSRKINFFVILLCALSQIII HFIYFLHLDFSKKNSWNIISLLFILIIVFIIVFGSIWIMYNLNHHVIL

Protein Names:Recommended name: Cytochrome o ubiquinol oxidase protein CyoD

Gene Names:Name:cyoD Ordered Locus Names:BUsg_453

Expression Region:1-108

Sequence Info:full length protein

View full details