Gene Bio Systems
Recombinant Buchnera aphidicola subsp. Myzus persicae Membrane protein insertase YidC(yidC)
Recombinant Buchnera aphidicola subsp. Myzus persicae Membrane protein insertase YidC(yidC)
SKU:CSB-CF523792BXD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Buchnera aphidicola subsp. Myzus persicae (Myzus persicae primary endosymbiont)
Uniprot NO.:O51829
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SRTLIKSKLWVGPEIQKEMKLVAPNLDLTVDYGWLWFLSQPLFKLLTIINSIINNWGFSI ILITFIMKIITYPLTKSQYVSMSKIRALQPKIKEIKEAFSDNKQRISQEMIILYKKEKIN PLGGFLPVFIQMPVFLSLYYMLIGSVELRHAPFVLWIKDLSSQDPFYVLPIIMGLTMFFI QKTSSNNISDPIQKKIMNFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQKFIFSNFKSN
Protein Names:Recommended name: Membrane protein insertase YidC Alternative name(s): Foldase YidC Membrane integrase YidC Membrane protein YidC
Gene Names:Name:yidC
Expression Region:1-240
Sequence Info:full length protein
