Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum  UPF0092 membrane protein BU134 (BU134)

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum UPF0092 membrane protein BU134 (BU134)

CSB-CF348123BWZ
Regular price
€1.005,95 EUR
Sale price
€1.005,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)

Uniprot NO.:P57234

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFFIQNANAVVNGTSESSNSYSLIFMAVIFLLIFYFMLFRPQQKKDKEHKNLINSLVQG DEVITTSGLLGRIKKITKNGYILLELNETTEVFIKQDFIVSLLPKGTLKSL

Protein Names:Recommended name: UPF0092 membrane protein BU134

Gene Names:Ordered Locus Names:BU134

Expression Region:1-111

Sequence Info:full length protein

Your list is ready to share