Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Brucella canis (strain ATCC 23365 / NCTC 10854)
Uniprot NO.:A9M8G0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFVSTAFAQTATESQPASTAGEHGAADAVHTETGVAHDAGHGSGVFPPFDSTHYASQVLW LAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELAQAR SKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEETTA TIVEQLLGLTADKASVSEAVKAIRASNA
Protein Names:Recommended name: ATP synthase subunit b 1 Alternative name(s): ATP synthase F(0) sector subunit b 1 ATPase subunit I 1 F-type ATPase subunit b 1 Short name= F-ATPase subunit b 1
Gene Names:Name:atpF1 Ordered Locus Names:BCAN_A0389
Expression Region:1-208
Sequence Info:full length protein