Skip to product information
1 of 1

Gene Bio Systems

Recombinant Brucella abortus Probable intracellular septation protein A(BAB1_1935)

Recombinant Brucella abortus Probable intracellular septation protein A(BAB1_1935)

SKU:CSB-CF649803BMN

Regular price €1.500,95 EUR
Regular price Sale price €1.500,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Brucella abortus (strain 2308)

Uniprot NO.:Q2YLU9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEHPVFERDPSEKSETERREVPPLLKLALELGPLLVFFFANARGEMLIERFPILGSIGAP IFLATALFMAATVIALAISWSMTRTLPIMPLVSGIVVLVFGALTLWLHNDTFIKMKPTIV NTLFGGILLGGLFFGKSLLGYVFDSAFRLDAEGWRKLTLRWGLFFIFLAIVNEIVWRNFS TDTWVSFKVWGIMPITIVFTLLQMPLIQKHSLTDEENTAS

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:BAB1_1935

Expression Region:1-220

Sequence Info:full length protein

View full details