Gene Bio Systems
Recombinant Bradyrhizobium sp. ATP synthase subunit a 2(atpB2)
Recombinant Bradyrhizobium sp. ATP synthase subunit a 2(atpB2)
SKU:CSB-CF398977BPE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Uniprot NO.:A5EBW8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQSSPLTSTLLFHIGPVAITRPVVTTWVIMAALALVCRFVTRRLAILPDGRQALLEGIVT SVAGQIEDVIRKDARPFLPLLGTLIIFLVVANLSGVLPGVEAPTSKIETPAALALIVFFS VHYFGVRERGLRGYLASFAEPKLIMLPLNILSEITRTFSLMVRLFGNIMSGEFIIGLVVA LAGLFVPIPLMALEILVGLVQAYIFTVLATVFIGAAVGSVAKG
Protein Names:Recommended name: ATP synthase subunit a 2 Alternative name(s): ATP synthase F0 sector subunit a 2 F-ATPase subunit 6 2
Gene Names:Name:atpB2 Ordered Locus Names:BBta_1436
Expression Region:1-223
Sequence Info:full length protein
