Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bradyrhizobium japonicum Probable intracellular septation protein A (bll0472)

Recombinant Bradyrhizobium japonicum Probable intracellular septation protein A (bll0472)

SKU:CSB-CF327011BVW

Regular price €1.488,95 EUR
Regular price Sale price €1.488,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bradyrhizobium japonicum (strain USDA 110)

Uniprot NO.:P30961

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDKTQPHPLFKLATELGPLLVFFFVNAKFNLFAATGAFMVAIVAAMIASYVVTRHIPIMA IVTGVIVLVFGTLTLVLHDETFIKVKPTIIYGLFAAILGGGLLFGRSFIAVMFDQMFNLT PQGWRILTLRWALFFAGMAVLNEIVWRTQSTDFWVNFKVFGVTPITMIFAIAQMPLTKRY HLEPVSLEASEADAGDVRKG

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:bll0472

Expression Region:1-200

Sequence Info:full length protein

View full details