Gene Bio Systems
Recombinant Bradyrhizobium japonicum Heme exporter protein D(cycX)
Recombinant Bradyrhizobium japonicum Heme exporter protein D(cycX)
SKU:CSB-CF330039BVW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bradyrhizobium japonicum (strain USDA 110)
Uniprot NO.:P30959
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIMSLGPYASFIVTSYAAAALVVAILIGWIATDYRSQTRRLRDLDRSGITRRSGRSAMDR P
Protein Names:Recommended name: Heme exporter protein D Alternative name(s): Cytochrome c-type biogenesis protein CycX
Gene Names:Name:cycX Synonyms:ccmD Ordered Locus Names:bsr0470
Expression Region:1-61
Sequence Info:full length protein
