Gene Bio Systems
Recombinant Bovine UPF0697 protein C8orf40 homolog
Recombinant Bovine UPF0697 protein C8orf40 homolog
SKU:CSB-CF399766BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:A5D7B5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPGGYGVMGDDGAMDYSVHEAWNEATNVYLVVILVSFGLFMYAKRNKRKIMRIFSLPPPA ETLSEPNFYDTISKIRLRQQLEMYSISRKYDYQQPQSQADSVQLSLE
Protein Names:Recommended name: UPF0697 protein C8orf40 homolog
Gene Names:
Expression Region:1-107
Sequence Info:full length protein
