Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine respiratory syncytial virus Small hydrophobic protein(SH)

Recombinant Bovine respiratory syncytial virus Small hydrophobic protein(SH)

SKU:CSB-CF340636BVL

Regular price €1.347,95 EUR
Regular price Sale price €1.347,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bovine respiratory syncytial virus (strain A51908) (BRS)

Uniprot NO.:P24616

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNNTSTMIEFTGKFWTYFTLVFMMLIIGFFFVITSLVAAILNKLCDLNDHHTNSLDIRTG LRNDTQSITRAHV

Protein Names:Recommended name: Small hydrophobic protein Alternative name(s): Small protein 1A

Gene Names:Name:SH Synonyms:1A

Expression Region:1-73

Sequence Info:full length protein

View full details