Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Mitoferrin-1(SLC25A37)

Recombinant Bovine Mitoferrin-1(SLC25A37)

SKU:CSB-CF674719BO

Regular price €1.452,95 EUR
Regular price Sale price €1.452,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q3ZBJ8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELRRGGVGSQARARRMDGDSRDGGGGCKDAGSEDYENLPTSASLSTHMTAGAMAGILEH SVMYPVDSVKTRMQSLNPDPKAHYTSVYGALKKIIRTEGFWRPLRGLNVMMMGAGPAHAM YFACYENMKRTLNAVFHHQGNSHLANGICKRLSGVRKVSPSTDPSPGFSSL

Protein Names:Recommended name: Mitoferrin-1 Alternative name(s): Mitochondrial iron transporter 1 Solute carrier family 25 member 37

Gene Names:Name:SLC25A37 Synonyms:MFRN

Expression Region:1-171

Sequence Info:full length protein

View full details