Gene Bio Systems
Recombinant Bovine Mitoferrin-1(SLC25A37)
Recombinant Bovine Mitoferrin-1(SLC25A37)
SKU:CSB-CF674719BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:Q3ZBJ8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MELRRGGVGSQARARRMDGDSRDGGGGCKDAGSEDYENLPTSASLSTHMTAGAMAGILEH SVMYPVDSVKTRMQSLNPDPKAHYTSVYGALKKIIRTEGFWRPLRGLNVMMMGAGPAHAM YFACYENMKRTLNAVFHHQGNSHLANGICKRLSGVRKVSPSTDPSPGFSSL
Protein Names:Recommended name: Mitoferrin-1 Alternative name(s): Mitochondrial iron transporter 1 Solute carrier family 25 member 37
Gene Names:Name:SLC25A37 Synonyms:MFRN
Expression Region:1-171
Sequence Info:full length protein
