Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine coronavirus Membrane protein(M)

Recombinant Bovine coronavirus Membrane protein(M)

SKU:CSB-CF302486BJI

Regular price €1.514,95 EUR
Regular price Sale price €1.514,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bovine coronavirus (strain LSU-94LSS-051) (BCoV-LSU) (BCV)

Uniprot NO.:P69599

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSVTTPAPVYTWTADEAIKFLKEWNFSLGIILLFITVILQFGYTSRSMFVYVIKMIILW LMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWIVYFVNSIRLFIRTGSWWSFNPE TNNLMCIDMKGRMYVRPIIEDYHTLTVTIIRGHLYMQGIKLGTGYSLSDLPAYVTVAKVS HLLTYKRGFLDKIGDTSGFAVYVKSKVGNYRLPSTQKGSGMDTALLRNNI

Protein Names:Recommended name: Membrane protein Short name= M protein Alternative name(s): E1 glycoprotein Matrix glycoprotein Membrane glycoprotein

Gene Names:Name:M ORF Names:6

Expression Region:1-230

Sequence Info:full length protein

View full details