Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine CD320 antigen(CD320)

Recombinant Bovine CD320 antigen(CD320)

SKU:CSB-CF004924BO

Regular price €1.507,95 EUR
Regular price Sale price €1.507,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A6QNY1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LEIAPTPIQTWSPTQAPGPSAGSCPPTNFQCRSDGRCLPLIWRCDVDQDCPDGSDEEECGTEVPNGSPSPCDIMDDCPDHNKNLLNCGPQSCPEGELCCPLDGVCIPSTWLCDGHRDCSDYSDELGCGTKTHEEGRTMSTGTPVTLENVTYLSNATVTAIEDWDSVQSGNRNVYGIIAAVAVLSISLAAGILFALSRLCAQGCLAPLGLLVSMKGSLQPEKKTSVL

Protein Names:Recommended name: CD320 antigen Alternative name(s): Transcobalamin receptor Short name= TCblR CD_antigen= CD320

Gene Names:Name:CD320

Expression Region:30-255

Sequence Info:full length protein

View full details