Gene Bio Systems
Recombinant Bovine CD320 antigen(CD320)
Recombinant Bovine CD320 antigen(CD320)
SKU:CSB-CF004924BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:A6QNY1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LEIAPTPIQTWSPTQAPGPSAGSCPPTNFQCRSDGRCLPLIWRCDVDQDCPDGSDEEECGTEVPNGSPSPCDIMDDCPDHNKNLLNCGPQSCPEGELCCPLDGVCIPSTWLCDGHRDCSDYSDELGCGTKTHEEGRTMSTGTPVTLENVTYLSNATVTAIEDWDSVQSGNRNVYGIIAAVAVLSISLAAGILFALSRLCAQGCLAPLGLLVSMKGSLQPEKKTSVL
Protein Names:Recommended name: CD320 antigen Alternative name(s): Transcobalamin receptor Short name= TCblR CD_antigen= CD320
Gene Names:Name:CD320
Expression Region:30-255
Sequence Info:full length protein
