Recombinant Bovine C-C motif chemokine 20(CCL20)

SKU: CSB-EP840478BO

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q8SQB1

Gene Names: CCL20

Organism: Bos taurus (Bovine)

AA Sequence: ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM

Expression Region: 27-96aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 24.1 kDa

Alternative Name(s): Macrophage inflammatory protein 3 alpha ;MIP-3-alpha;Small-inducible cytokine A20

Relevance: Chotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells .

Reference: The role of chemokines in bovine respiratory syncytial virus infection.Neuenschwander S., Werling D.

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.