Recombinant Bovine Bifunctional methylenetetrahydrofolate dehydrogenase-cyclohydrolase, mitochondrial(MTHFD2)

SKU: CSB-EP606691BO

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Metabolism

Uniprot ID: Q0P5C2

Gene Names: MTHFD2

Organism: Bos taurus (Bovine)

AA Sequence: EAVVISGRKLAEQIKQEVRQEVEEWVASGNKRPHLSVVLVGENPASQSYVLNKTRAAASVGINSETILKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERKVCNAVSPDKDVDGFHVINVGRMCLDQCSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEELKKHTALADIVISAAGIPNLITADMIKEGAAVIDVGINRIQDPITAKPKLVGDVDFEGVKKKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEQEVLKSKELGVASN

Expression Region: 36-350aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 49.9 kDa

Alternative Name(s): NAD-dependent methylenetetrahydrofolate dehydrogenase Methenyltetrahydrofolate cyclohydrolase

Relevance: 5,10-methylenetetrahydrofolate + NAD+ = 5,10-methenyltetrahydrofolate + NADH. 5,10-methenyltetrahydrofolate + H2O = 10-formyltetrahydrofolate.

Reference: NIH - Mammalian Gene Collection (MGC) project Submitted (AUG-2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.