Skip to product information
1 of 1

Gene Bio Systems

Recombinant Borrelia burgdorferi Uncharacterized protein BB_0539 (BB_0539)

Recombinant Borrelia burgdorferi Uncharacterized protein BB_0539 (BB_0539)

SKU:CSB-CF523779BUD

Regular price €1.517,95 EUR
Regular price Sale price €1.517,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

Uniprot NO.:O51489

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIDLTQEKQEILIKNKFLAKVFGLMSIGLLISAVFAYATSENQTIKAIIFSNSMSFMAMI LIQFGLVYAISGALNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGITAGTF LGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNFLISILGVVIFTGLTA YDVQNISKMDKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRND

Protein Names:Recommended name: Uncharacterized protein BB_0539

Gene Names:Ordered Locus Names:BB_0539

Expression Region:1-232

Sequence Info:full length protein

View full details