Gene Bio Systems
Recombinant Bordetella pertussis Pertactin autotransporter(prn),partial
Recombinant Bordetella pertussis Pertactin autotransporter(prn),partial
SKU:CSB-EP321224BUA
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P14283
Gene Names: prn
Organism: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
AA Sequence: ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTRGDRGFTGDGGGHTDSVHVGGYATYIADSGFYLDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAGRRFTHADGWFLEPQAELAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKASVLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW
Expression Region: 632-910aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 45.8 kDa
Alternative Name(s): P.93
Relevance: Agglutinogen that binds to eukaryotic cells; a process mediated by the R-G-D sequence. Pertactin may have a role in bacterial adhesion, and thus play a role in virulence. May contribute to the disease state of whooping cough.
Reference: Structure of Bordetella pertussis virulence factor P.69 pertactin.Emsley P., Charles I.G., Fairweather N.F., Isaacs N.W.Nature 381:90-92(1996)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.