Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bifidobacterium longum ATP synthase subunit c(atpE)

Recombinant Bifidobacterium longum ATP synthase subunit c(atpE)

SKU:CSB-CF455206BTA

Regular price €1.209,95 EUR
Regular price Sale price €1.209,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bifidobacterium longum (strain DJO10A)

Uniprot NO.:B3DTV5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDIITLAEVAGNLSVIGYGIGTLGPGIGLGILFGKAMESTARQPEMSGKIQTIMFIGLAL VEVLALIGFVAALII

Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein

Gene Names:Name:atpE Ordered Locus Names:BLD_1128

Expression Region:1-75

Sequence Info:full length protein

View full details