Skip to product information
1 of 1

Gene Bio Systems

Recombinant Beta vulgaris subsp. maritima CASP-like protein Ni6(Ni6)

Recombinant Beta vulgaris subsp. maritima CASP-like protein Ni6(Ni6)

SKU:CSB-CF515029BSR

Regular price €1.477,95 EUR
Regular price Sale price €1.477,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Beta vulgaris subsp. maritima (Sea beet) (Beta maritima)

Uniprot NO.:D2KQI6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSMETEKGAVPTPQAPPVAPTDNKYRVVDVILRVLLLAASIASVVLMVTSKQTEIIVSP FGSRPNAAKFQNSPAFIYLVAALSVAGLYSIITALVSLSYMRKPIVPPKLFWILLIHDVL LLGIVAAATGTAGGVGYIGLKGNTHVRWGKIRNVYDKFCRHVGASIIVSLFAAAVLVLLV FVNANSLYRRIPKY

Protein Names:Recommended name: CASP-like protein Ni6

Gene Names:Name:Ni6

Expression Region:1-194

Sequence Info:full length protein

View full details