Gene Bio Systems
Recombinant Beet necrotic yellow vein virus Movement protein TGB3
Recombinant Beet necrotic yellow vein virus Movement protein TGB3
SKU:CSB-CF737464BSO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Beet necrotic yellow vein virus (isolate Japan/S) (BNYVV)
Uniprot NO.:Q65676
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVLVVKVDLSNIVLYIVAGCVVVSMLYSPFFSNDVKASSYAGAVFKGSGCIMDRNSFAQF GSCDIPKHVAESITKVATKEHDADIMVKRGEVTVRVVTLTETLFIILSRLFGLAVFLFMI CLMSIVWFWCHR
Protein Names:Recommended name: Movement protein TGB3 Alternative name(s): 15 kDa protein P15 Triple gene block 3 protein Short name= TGBp3
Gene Names:
Expression Region:1-132
Sequence Info:full length protein
