Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacteroides thetaiotaomicron Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)

Recombinant Bacteroides thetaiotaomicron Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)

SKU:CSB-CF806766BDU

Regular price €1.522,95 EUR
Regular price Sale price €1.522,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

Uniprot NO.:Q8A8H2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHRPLPIKKILRYARNLLIFFFASTILAVIVYRFMPVYVTPLMVIRSVQQLASGDKPTWK HTWVSFDKISPHLPMAVIASEDNRFAEHNGFDFIEIEKAMKENEKRKRKRGASTISQQTA KNVFLWPQSSWVRKGFEVYFTFLIELFWSKERIMEVYLNSIEMGKGIYGAQATAKYKFNT TAAKLSSGQCALIAATLPNPIRFNSAKPSAYLLKRQKQILRLMNLVPKFPPVEKKAVDKK DTRKKKKK

Protein Names:Recommended name: Monofunctional biosynthetic peptidoglycan transglycosylase Short name= Monofunctional TGase EC= 2.4.2.-

Gene Names:Name:mtgA Ordered Locus Names:BT_1195

Expression Region:1-248

Sequence Info:full length protein

View full details