Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacteroides fragilis UPF0059 membrane protein BF1183(BF1183)

Recombinant Bacteroides fragilis UPF0059 membrane protein BF1183(BF1183)

SKU:CSB-CF734173BDQ

Regular price €1.471,95 EUR
Regular price Sale price €1.471,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacteroides fragilis (strain YCH46)

Uniprot NO.:Q64X43

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTGLEIWLLAIGLAMDCLAVSIASGIILRRIQWRPMLIMAFFFGLFQAIMPLLGWLGAST FSHLIESVDHWIAFAILAFLGGRMIKESFKEEDCCQRFNPASLKVVITMAVATSIDALAV GVSFAFLGIKSCSSILYPAGIIGFVSFFMSLIGLIFGIRFGCGIARKLRAELWGGIILIL IGTKILIEHLFFNN

Protein Names:Recommended name: UPF0059 membrane protein BF1183

Gene Names:Ordered Locus Names:BF1183

Expression Region:1-194

Sequence Info:full length protein

View full details