Recombinant Bacillus subtilis  Uncharacterized protein ytvB(ytvB)

Recombinant Bacillus subtilis Uncharacterized protein ytvB(ytvB)

CSB-CF520278BRJ
Regular price
€1.005,95 EUR
Sale price
€1.005,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O34881

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKMLHQVLIACVIGGIMGILGHVKKRGRLEKPRMTKRFIYLGFLEDWFIGMTASILLVLS ADPDSGIQLVILSIISGYGGEAVLRSFDFVRELNSGGEPAESKRQTKTPPE

Protein Names:Recommended name: Uncharacterized protein ytvB

Gene Names:Name:ytvB Ordered Locus Names:BSU30330

Expression Region:1-111

Sequence Info:full length protein

Your list is ready to share