Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Uncharacterized protein yqhV(yqhV)

Recombinant Bacillus subtilis Uncharacterized protein yqhV(yqhV)

SKU:CSB-CF344609BRJ

Regular price €1.375,95 EUR
Regular price Sale price €1.375,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P49779

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKFLLGNINSTVLTMAGLRVLSSMIELTAAIVMLVTNDVRKAVVVNSILAIVGPLIFIIT MTVGIYQIAGQLSYAKLILIFTGVVLILAGVHK

Protein Names:Recommended name: Uncharacterized protein yqhV

Gene Names:Name:yqhV Synonyms:yqgE Ordered Locus Names:BSU24440

Expression Region:1-93

Sequence Info:full length protein

View full details