
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:P96702
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MISIMMKVSLAVFMLAGGIIKVSRVPFQVEHWRHYQYPLWFLTVTGILEIAGALAMTAGI WNRYAAIGAGVLFVVLMAGAIHAHMFRARQSVIMAIQAMICLIVSIMIIMGSYT
Protein Names:Recommended name: Uncharacterized protein ydgD
Gene Names:Name:ydgD Ordered Locus Names:BSU05590
Expression Region:1-114
Sequence Info:full length protein
You may also like
-
Recombinant Bacillus subtilis Uncharacterized protein yddD(yddD)
- Regular price
- €1.313,95 EUR
- Sale price
- €1.313,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis Uncharacterized protein yjdJ(yjdJ)
- Regular price
- €1.231,95 EUR
- Sale price
- €1.231,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis Uncharacterized protein ydbL(ydbL)
- Regular price
- €1.255,95 EUR
- Sale price
- €1.255,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis Uncharacterized protein yfhL(yfhL)
- Regular price
- €1.254,95 EUR
- Sale price
- €1.254,95 EUR
- Regular price
-
- Unit price
- per
Sold out