Gene Bio Systems
Recombinant Bacillus subtilis Uncharacterized membrane protein yjzD(yjzD)
Recombinant Bacillus subtilis Uncharacterized membrane protein yjzD(yjzD)
SKU:CSB-CF521993BRJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:O34713
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRYIIAFIWTFLLSHMACYLVASMNSVTYNFKTSSVIAVVLYVLIMVLAEIMPMNKNASQ H
Protein Names:Recommended name: Uncharacterized membrane protein yjzD
Gene Names:Name:yjzD Ordered Locus Names:BSU11270
Expression Region:1-61
Sequence Info:full length protein