Recombinant Bacillus subtilis S-ribosylhomocysteine lyase(luxS)

Recombinant Bacillus subtilis S-ribosylhomocysteine lyase(luxS)

CSB-EP518511BRJ
Regular price
€743,95 EUR
Sale price
€743,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: O34667

Gene Names: LUXS

Organism: Bacillus subtilis (strain 168)

AA Sequence: MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG

Expression Region: 1-157aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 21.7 kDa

Alternative Name(s): AI-2 synthesis protein Autoinducer-2 production protein LuxS

Relevance: Involved in the synthesis of autoinducer 2 (AI-2) which is secreted by bacteria and is used to communicate both the cell density and the metabolic potential of the environment. The regulation of gene expression in response to changes in cell density is called quorum sensing. Catalyzes the transformation of S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentadione (DPD).

Reference: "The 1.2 A structure of a novel quorum-sensing protein, Bacillus subtilis LuxS." Ruzheinikov S.N., Das S.K., Sedelnikova S.E., Hartley A., Foster S.J., Horsburgh M.J., Cox A.G., McCleod C.W., Mekhalfia A., Blackburn G.M., Rice D.W., Baker P.J. J. Mol. Biol. 313:111-122(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share