Recombinant Bacillus subtilis  Quinol oxidase subunit 4(qoxD)

Recombinant Bacillus subtilis Quinol oxidase subunit 4(qoxD)

CSB-CF335996BRJ
Regular price
€1.021,95 EUR
Sale price
€1.021,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P34959

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ANKSAEHSHFPWKHIVGFILSIVLTLLALWVAVYTDLSSSAKLWIIFGFAFIQAALQLLM FMHMTESENGTIQVGNTLFGFFGAIVIVLGSIWIFAAHYHHGDHMDGNPPGGAEHSEHSG HNE

Protein Names:Recommended name: Quinol oxidase subunit 4 EC= 1.10.3.- Alternative name(s): Quinol oxidase aa3-600, subunit QoxD Quinol oxidase polypeptide IV

Gene Names:Name:qoxD Ordered Locus Names:BSU38140 ORF Names:ipa-40d

Expression Region:2-124

Sequence Info:full length protein

Your list is ready to share