Gene Bio Systems
Recombinant Bacillus subtilis Putative lipid phosphate phosphatase yodM(yodM)
Recombinant Bacillus subtilis Putative lipid phosphate phosphatase yodM(yodM)
SKU:CSB-CF516476BRJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:O34349
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:DEAISKAAVLIRQPWLNEVMTGITHLGASSFLLPLIVIIGAGMFFYRKTWDGLLMLLVFG TDRLLNKVLKEWIERVRPDFAPLVHESSFSFPSGHSMNAACVYPVIAYFLVKHLPFLSKH KKMVYIIAGVIAVLVGISRVYLGVHFVTDVLGGFSLGLLLFFLVKGFDEKIKRFRQK
Protein Names:Recommended name: Putative lipid phosphate phosphatase yodM EC= 3.1.3.-
Gene Names:Name:yodM Ordered Locus Names:BSU19650
Expression Region:27-203
Sequence Info:full length protein
