Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Penicillin-binding protein 4(pbpD) ,partial

Recombinant Bacillus subtilis Penicillin-binding protein 4(pbpD) ,partial

SKU:CSB-EP334764BRJ

Regular price €911,95 EUR
Regular price Sale price €911,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: others

Target / Protein: pbpD

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Bacillus subtilis (strain 168)

Delivery time: 3-7 business days

Uniprot ID: P40750

AA Sequence: PNNPTLYDPLKHFDYTKSRQERLLKGLKDAGVITDKELKKAVKQKIKLDVEKREDKYPDYVSYVNDEFTQLVSESEGFDKRLQKASGKQKEKIENELSARVSTLMKDGVKIYTALDPYMQNQVVAQMNSKLPYADVQGGAAVINHQTHQIIALSGGKNYQKYDFNRAYQAYRQPGSSIKPLLDYGPYIEQTGATTSSTIDASKFCSKDYCPQNYNNRTYGTVTLDTAFKNSYNTPAIR

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 213-450AA

Protein length: Partial

MW: 43 kDa

Alternative Name(s):

Relevance:

Reference: "From a consortium sequence to a unified sequence: the Bacillus subtilis 168 reference genome a decade later." Barbe V., Cruveiller S., Kunst F., Lenoble P., Meurice G., Sekowska A., Vallenet D., Wang T., Moszer I., Medigue C., Danchin A. Microbiology 155:1758-1775(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details