Gene Bio Systems
Recombinant Bacillus cereus Probable disulfide formation protein C(bdbC)
Recombinant Bacillus cereus Probable disulfide formation protein C(bdbC)
SKU:CSB-CF772271BAM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus cereus (strain ATCC 14579 / DSM 31)
Uniprot NO.:Q81HM5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGREKKQEYALLTAWGASFIATLGSLYFSEIMKFEPCVLCWYQRIFMYPFVLWLGIAVAK KDYRIASYSLPIASIGACISLYHYAIQKVAAFSAAGAACGRVPCTGEYINWFGFVTIPFL ALIGFITIAVCSFIVIKNK
Protein Names:Recommended name: Probable disulfide formation protein C Alternative name(s): Disulfide oxidoreductase C Thiol-disulfide oxidoreductase C
Gene Names:Name:bdbC Ordered Locus Names:BC_0779
Expression Region:1-139
Sequence Info:full length protein
