Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus cereus Antiholin-like protein LrgA(lrgA)

Recombinant Bacillus cereus Antiholin-like protein LrgA(lrgA)

SKU:CSB-CF478692BQL

Regular price €1.430,95 EUR
Regular price Sale price €1.430,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain AH187)

Uniprot NO.:B7HZC4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTKKVYSFLSQAFIFSAIMLISNIIATHLPIPMPSSVIGLVILFSLLCLKVIKLEQVES LGTALTGIIGFLFVPSGISVINSLGVMGQYFVQILTVIVVATVILLAVTGLFAQFILGKD KKETEDTKELKVVNKGRKHGKVA

Protein Names:Recommended name: Antiholin-like protein LrgA

Gene Names:Name:lrgA Ordered Locus Names:BCAH187_A5620

Expression Region:1-143

Sequence Info:full length protein

View full details